known·good search mcp servers how we grade about the index

search / community / iears.us

Imaginears Club | Disney-Themed Minecraft Server

iears.us · visit site →

Probe-verified · tier 2 · checked 23 Aug 2026

Imaginears Club is a Disney-themed Minecraft server featuring 1:1 recreations of Disney parks, rides, and creative plots for family-friendly adventures.

minecraft serverminecraftdisneyridesparks

What we tested

Probed live on 23 Aug 2026 against rubric v1. 1 of 5 checks passed.

PROBE-VERIFIEDtier 2 of 3
Markdown negotiationAccept: text/markdown
Markdown twin at a predictable URL/page.md
llms.txt/llms.txt
API catalogRFC 9727
MCP server answers/.well-known/mcp/server-card.json → tools/list

What an agent could do here

Read from the page’s own content, with the wording each was drawn from. Inference is kept separate from tested facts — an agent completing the action is tier 3.

UNVERIFIED
register“Become A Passholder”
https://store.imaginears.club/
contact“Join Our Discord”
https://discord.com/invite/zApx2kC

Context

4 sites in the index share the category minecraft server, of which 4 are transactional.

How we grade

Three tiers. Every listing shows which one it has reached, and when. The rubric.

tier 1
Declared
The site says agents are welcome in its robots.txt. A permission, not a capability.
tier 2
Probe-verified
We fetched the site and tested each signal ourselves. Dated, repeatable, re-checked on a schedule.
this site · 23 Aug 2026
tier 3
Behaviourally verified
An agent completed the action end to end — booked, bought, submitted — and it worked.
coming
Own this site?

4 checks did not pass when we last looked: Markdown twin at a predictable URL, llms.txt, API catalog, MCP server answers. Each is a small, specific fix; the rubric says exactly what we look for.

Behavioural verification — an agent completing your booking, purchase or contact flow end to end, with the date published here — opens to a small founding cohort first. Leave an email to be in it.

Related verified sites

WIKI
Instructions for beginners to join and play on the Lotus private Minecraft server via Disc
minecraft server
Trinity Indonesia server Minecraft Anarchy RPG
Trinity Indonesia is a Minecraft Anarchy Economy 2.0 server offering free PvP, player-driv
minecraft server
Imaginears Club | Disney-Themed Minecraft Server
Imaginears Club is a Disney-themed Minecraft server featuring 1:1 recreations of Disney pa
minecraft server
Immersive Commons
Immersive Commons is a members-run applied-AI lab on Floor 10 of Frontier Tower, San Franc
applied-ai lab
雲嘉生活圈
A listing of 10 recent weekend events, exhibitions, markets, and family activities in Yunl
event listing
DuaCrypto
DuaCrypto is Albania's first Bitcoin and crypto community offering education, events, and
bitcoin and crypto community
HiRey
HiRey is a people network that facilitates trusted introductions through human Connectors
people network
Lets Read The Bible
Lets Read The Bible offers free access to the Catholic Public Domain Version Bible, prayer
catholic scripture reading

Record generated from a live database query. Method: about the index.